PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0917s0078.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22513.9 Da    PI: 8.4769
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0917s0078.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.76.3e-23959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krie+k  rqvtf+kRrng++ KA  LSvLC+  va+ i+sstgkly +ss
  Cagra.0917s0078.1.p  9 KRIEDKNSRQVTFCKRRNGLMEKARQLSVLCGSSVALFIVSSTGKLYSFSS 59
                         79***********************************************96 PP

2K-box37.41.1e-131111654599
                K-box  45 sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          + s++ L ++e+qL+k+l+  R++K+el++e++++lq kek l+een+ L +++ 
  Cagra.0917s0078.1.p 111 NVSVESLISIEEQLKKALSVTRARKTELIMEHVKTLQDKEKLLEEENQVLARQMR 165
                          578999********************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554559.81E-26173IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.637161IPR002100Transcription factor, MADS-box
CDDcd002652.81E-31279No hitNo description
PRINTSPR004042.5E-23323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.76779170IPR002487Transcription factor, K-box
PfamPF014863.2E-10109164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0048587Biological Processregulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRRRVEIKR IEDKNSRQVT FCKRRNGLME KARQLSVLCG SSVALFIVSS TGKLYSFSSG  60
DSLAKTLSRY EIQNADDHTT LDLAEKTQDH ISNKELLEII QCKLEEVKSD NVSVESLISI  120
EEQLKKALSV TRARKTELIM EHVKTLQDKE KLLEEENQVL ARQMREMKKV LGTEDELAMS  180
PENSFGSKQP ETLRLLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A5e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D5e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A6e-16270168Myocyte-specific enhancer factor 2A
3kov_B6e-16270168Myocyte-specific enhancer factor 2A
3kov_I6e-16270168Myocyte-specific enhancer factor 2A
3kov_J6e-16270168Myocyte-specific enhancer factor 2A
3p57_A6e-16270168Myocyte-specific enhancer factor 2A
3p57_B6e-16270168Myocyte-specific enhancer factor 2A
3p57_C6e-16270168Myocyte-specific enhancer factor 2A
3p57_D6e-16270168Myocyte-specific enhancer factor 2A
3p57_I6e-16270168Myocyte-specific enhancer factor 2A
3p57_J6e-16270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010444482.11e-115PREDICTED: protein MADS AFFECTING FLOWERING 5-like
SwissprotQ683D71e-94MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5
TrEMBLA0A087GE928e-97A0A087GE92_ARAAL; Uncharacterized protein
STRINGBra031884.1-P1e-94(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65070.19e-97MIKC_MADS family protein